PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco014780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family BBR-BPC
Protein Properties Length: 274aa    MW: 30334.6 Da    PI: 10.4428
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco014780.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind296.51.1e-9012731301
    GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssiaerdakirernlalsekkaavaerd..maflqrdkalaernkalverdnkllalllvenslasal 95 
                  md +g    rn+gyy++   +k n glqlmss+ae+++k+  +n  + +++ +  e    ++f  ++++ +        r+ k+ ++++++       
  Aco014780.1   1 MDANGGLGmRNWGYYDQP--IKVNPGLQLMSSVAEHEKKQLFSNGGFLQRDYSAPETFapIEF-LKNSWPNY-------REAKMPQMMPTNP------ 82 
                  777777777********9..9999*********999998877777555544433322122666.45556555.......8999999999554...... PP

    GAGA_bind  96 pvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekks 193
                    +++ l+ ++ ++s q      ++ ++ +  +    ++ p   ++++a++ k +kkr+ra+ + ++k +k+kk  +++k++ k +s ++r+++ +ks
  Aco014780.1  83 --SYDLLPSANGAHSFQI-----MQAPSPP--KD--DNVAP--MNEPQATNDKPPKKRSRARPESASKPRKPKK-APVPKEERKVNS-NPRVRNGRKS 165
                  ..4889999999998888.....3333333..22..23444..456788888999999999999999*****99.667777777777.48******** PP

    GAGA_bind 194 idlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAk 291
                   d+v+ng++lD s+lP+PvCsCtGa++qCY+WG GGWqSaCCtt+iSvyPLP+stkrrg+RiagrKmSqgaf+k+LekLa+eGy+l+np+DL+ +WAk
  Aco014780.1 166 ADIVINGIDLDLSGLPTPVCSCTGAPQQCYRWGVGGWQSACCTTSISVYPLPMSTKRRGSRIAGRKMSQGAFRKVLEKLAGEGYNLNNPIDLRAYWAK 263
                  ************************************************************************************************** PP

    GAGA_bind 292 HGtnkfvtir 301
                  HGtnkfvtir
  Aco014780.1 264 HGTNKFVTIR 273
                  *********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062171.8E-981273IPR010409GAGA-binding transcriptional activator
SMARTSM012261.4E-1271273IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MDANGGLGMR NWGYYDQPIK VNPGLQLMSS VAEHEKKQLF SNGGFLQRDY SAPETFAPIE  60
FLKNSWPNYR EAKMPQMMPT NPSYDLLPSA NGAHSFQIMQ APSPPKDDNV APMNEPQATN  120
DKPPKKRSRA RPESASKPRK PKKAPVPKEE RKVNSNPRVR NGRKSADIVI NGIDLDLSGL  180
PTPVCSCTGA PQQCYRWGVG GWQSACCTTS ISVYPLPMST KRRGSRIAGR KMSQGAFRKV  240
LEKLAGEGYN LNNPIDLRAY WAKHGTNKFV TIR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010917292.11e-125PREDICTED: protein Barley B recombinant-like
RefseqXP_010917294.11e-125PREDICTED: protein Barley B recombinant-like
SwissprotQ8GUC31e-83BBR_HORVU; Protein Barley B recombinant
TrEMBLH1ZN781e-103H1ZN78_9MAGN; GAGA-binding transcriptional activator
STRINGVIT_01s0011g06380.t011e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22113697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.38e-75basic pentacysteine 2